Recombinant Human CREB3L4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TEY5

Gene Name: CREB3L4

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Asp191

End Site: Lys290

Coverage: 0.26

Isoelectric Point: 10.5

Core Sequence: DEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 86%, Pig - 96%, Cynomolgus monkey - 100%

Alternative gene names: AIBZIP; CREB4; JAL

Alternative protein names: Cyclic AMP-responsive element-binding protein 3-like protein 4; cAMP-responsive element-binding protein 3-like protein 4; Androgen-induced basic leucine zipper protein; AIbZIP; Attaching to CRE-like 1; ATCE1; Cyclic AMP-responsive element-binding protein 4; CREB-4; cAMP-responsive element-binding protein 4; Transcript induced in spermiogenesis protein 40; Tisp40; hJAL) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3-like protein 4]

Protein name: cAMP responsive element binding protein 3 like 4

Full length: 395 amino acids

Entry name: CR3L4_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-4307-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4307-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 148327