Recombinant Human CRYZ Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q08257

Gene Name: CRYZ

Expression System: Escherichia coli

Molecular Weight: 36 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Met1

End Site: Leu329

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Rat - 81%, Pig - 84%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Quinone oxidoreductase; NADPH:quinone reductase; Zeta-crystallin

Protein name: crystallin zeta

Full length: 329 amino acids

Entry name: QOR_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-3883-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3883-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 1429