Recombinant Human CTDSP1 Protein

Recombinant Human CTDSP1 Protein
Artikelnummer
ASBPP-10452-100
Verpackungseinheit
100 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9GZU7

Gene Name: CTDSP1

Expression System: Escherichia coli

Molecular Weight: 24 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Pro61

End Site: Val250

Coverage: 0.77

Isoelectric Point: 6

Core Sequence: PLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 45%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: NIF3; NLIIF; SCP1

Alternative protein names: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; Nuclear LIM interactor-interacting factor 3; NLI-IF; NLI-interacting factor 3; Small C-terminal domain phosphatase 1; SCP1; Small CTD phosphatase 1

Protein name: CTD small phosphatase 1

Full length: 261 amino acids

Entry name: CTDS1_HUMAN

Product panel: Enzyme
Mehr Informationen
Artikelnummer ASBPP-10452-100
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-10452-100
Verpackungseinheit 100 μg
Mengeneinheit STK
Human Gene ID 58190
Produktinformation (PDF)
×
MSDS (PDF)
×