Recombinant Human CTNND2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UQB3

Gene Name: CTNND2

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Ile51

End Site: Ser130

Coverage: 0.06

Isoelectric Point: 4.5

Core Sequence: ILASVKEQELQFERLTRELEAERQIVASQLERCKLGSETGSMSSMSSAEEQFQWQSQDGQKDIEDELTTGLELVDSCIRS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 51%

Alternative gene names: NPRAP

Alternative protein names: Catenin delta-2; Delta-catenin; GT24; Neural plakophilin-related ARM-repeat protein; NPRAP; Neurojungin

Protein name: catenin delta 2

Full length: 1225 amino acids

Entry name: CTND2_HUMAN

• Artikelnummer: ASBPP-3792-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3792-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 1501