Recombinant Human CWH43 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H720

Gene Name: CWH43

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Pro511

End Site: Glu680

Coverage: 0.25

Isoelectric Point: 7

Core Sequence: PIVKSEHHLLPSPEGEIAPAITLTVNISGKLVDFVVTHFGNHEDDLDRKLQAIAVSKLLKSSSNQVIFLGYITSAPGSRDYLQLTEHGNVKDIDSTDHDRWCEYIMYRGLIRLGYARISHAELSDSEIQMAKFRIPDDPTNYRDNQKVVIDHREVSEKIHFNPRFGSYKE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Pig - 92%, Cynomolgus monkey - 97%

Alternative gene names: PGAP2IP

Alternative protein names: PGAP2-interacting protein; Cell wall biogenesis protein 43 C-terminal homolog

Protein name: cell wall biogenesis 43 C-terminal homolog

Full length: 699 amino acids

Entry name: PG2IP_HUMAN

• Artikelnummer: ASBPP-3816-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3816-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 80157