Recombinant Human CYP4F8 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P98187

Gene Name: CYP4F8

Expression System: Escherichia coli

Molecular Weight: 71.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Asp211

End Site: Ala450

Coverage: 0.48

Isoelectric Point: 5.5

Core Sequence: DSNCQEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFHRACRLVHDFTDAVIQERRRTLTSQGVDDFLQAKAKSKTLDFIDVLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCLKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVCNINIFAIHHNPSVWPDPEVYDPFRFDPENA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 78%, Pig - 83%, Cynomolgus monkey - 92%

Alternative gene names: /

Alternative protein names: Cytochrome P450 4F8; CYPIVF8

Protein name: cytochrome P450 family 4 subfamily F member 8

Full length: 520 amino acids

Entry name: CP4F8_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-3833-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3833-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 11283