Recombinant Human DDIT3 Protein

Recombinant Human DDIT3 Protein
Artikelnummer
ASBPP-4098-20
Verpackungseinheit
20 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: P35638

Gene Name: DDIT3

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 88%

Start Site: Met1

End Site: Ala169

Coverage: 1.00

Isoelectric Point: 4.5

Core Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Rat - 90%, Pig - 95%, Cynomolgus monkey - 98%

Alternative gene names: CHOP; CHOP10; GADD153

Alternative protein names: DNA damage-inducible transcript 3 protein; DDIT-3; C/EBP zeta; C/EBP-homologous protein; CHOP; C/EBP-homologous protein 10; CHOP-10; CCAAT/enhancer-binding protein homologous protein; Growth arrest and DNA damage-inducible protein GADD153

Protein name: DNA damage-inducible transcript 3 protein (DDIT-3) (C/EBP zeta) (C/EBP-homologous protein) (CHOP) (C/EBP-homologous protein 10) (CHOP-10) (CCAAT/enhancer-binding protein homologous protein) (Growth arrest and DNA damage-inducible protein GADD153)

Full length: 169 amino acids

Entry name: DDIT3_HUMAN

Product panel: DNA binding & Chromatin
Mehr Informationen
Artikelnummer ASBPP-4098-20
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-4098-20
Verpackungseinheit 20 μg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF)
×