Recombinant Human DEFB118 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96PH6

Gene Name: DEFB118

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Tyr21

End Site: His120

Coverage: 0.84

Isoelectric Point: 7

Core Sequence: YSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVH

Homologies: Highest protein sequence identity to the following orthologs: Pig - 50%, Cynomolgus monkey - 88%

Alternative gene names: C20orf63; DEFB18; ESC42

Alternative protein names: Defensin beta 118; Beta-defensin 18; DEFB-18; Epididymal secretory protein 13.6; ESP13.6

Protein name: defensin beta 118

Full length: 123 amino acids

Entry name: DB118_HUMAN

• Artikelnummer: ASBPP-4031-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4031-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 117285