Recombinant Human DLX2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q07687

Gene Name: DLX2

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Glu141

End Site: Met210

Coverage: 0.24

Isoelectric Point: 11

Core Sequence: EIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 89%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Homeobox protein DLX-2

Protein name: distal-less homeobox 2

Full length: 328 amino acids

Entry name: DLX2_HUMAN

Product panel: Neuroscience Biomarkers,DNA binding & Chromatin

• Artikelnummer: ASBPP-3222-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3222-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 1746