Recombinant Human DPRX Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A6NFQ7

Gene Name: DPRX

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 42%

Start Site: Lys11

End Site: Gly100

Coverage: 0.56

Isoelectric Point: 10.5

Core Sequence: KDQMHSHRKRTMFTKKQLEDLNILFNENPYPNPSLQKEMASKIDIHPTVLQVWFKNHRAKLKKAKCKHIHQKQETPQPPIPEGGVSTSVG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 42%, Rat - 38%, Pig - 59%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Divergent paired-related homeobox

Protein name: divergent-paired related homeobox

Full length: 191 amino acids

Entry name: DPRX_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3101-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3101-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 503834