Recombinant Human DRD2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P14416

Gene Name: DRD2

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Lys221

End Site: Lys370

Coverage: 0.36

Isoelectric Point: 11.5

Core Sequence: KRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 93%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: D(2) dopamine receptor; Dopamine D2 receptor

Protein name: dopamine receptor D2

Full length: 443 amino acids

Entry name: DRD2_HUMAN

• Artikelnummer: ASBPP-4386-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4386-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 1813