Recombinant Human ENKD1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H0I2

Gene Name: ENKD1

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Asp41

End Site: Asp140

Coverage: 0.31

Isoelectric Point: 10.5

Core Sequence: DLLTSDRALDTTAPRGPCIGPGAGEILERGQRGVGDVLLQLEGISLGPGASLKRKDPKDHEKENLRRIREIQKRFREQERSREQGQPRPLKALWRSPKYD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Pig - 83%

Alternative gene names: C16orf48

Alternative protein names: Enkurin domain-containing protein 1

Protein name: enkurin domain containing 1

Full length: 346 amino acids

Entry name: ENKD1_HUMAN

• Artikelnummer: ASBPP-3753-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3753-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 84080