Recombinant Human EPS8L3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TE67

Gene Name: EPS8L3

Expression System: Escherichia coli

Molecular Weight: 51.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Leu11

End Site: Asn440

Coverage: 0.75

Isoelectric Point: 7.5

Core Sequence: LHRKEYSQNLTSEPTLLQHRVEHLMTCKQGSQRVQGPEDALQKLFEMDAQGRVWSQDLILQVRDGWLQLLDIETKEELDSYRLDSIQAMNVALNTCSYNSILSITVQEPGLPGTSTLLFQCQEVGAERLKTSLQKALEEELEQRPRLGGLQPGQDRWRGPAMERPLPMEQARYLEPGIPPEQPHQRTLEHSLPPSPRPLPRHTSAREPSAFTLPPPRRSSSPEDPERDEEVLNHVLRDIELFMGKLEKAQAKTSRKKKFGKKNKDQGGLTQAQYIDCFQKIKHSFNLLGRLATWLKETSAPELVHILFKSLNFILARCPEAGLAAQVISPLLTPKAINLLQSCLSPPESNLWMGLGPAWTTSRADWTGDEPLPYQPTFSDDWQLPEPSSQAPLGYQDPVSLRRGSHRLGSTSHFPQEKTHNHDPQPGDPN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 33%, Pig - 73%, Cynomolgus monkey - 92%

Alternative gene names: EPS8R3

Alternative protein names: Epidermal growth factor receptor kinase substrate 8-like protein 3; EPS8-like protein 3; Epidermal growth factor receptor pathway substrate 8-related protein 3; EPS8-related protein 3

Protein name: EPS8 signaling adaptor L3

Full length: 593 amino acids

Entry name: ES8L3_HUMAN

• Artikelnummer: ASBPP-4184-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4184-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 79574