Recombinant Human ERGIC1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q969X5

Gene Name: ERGIC1

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Glu51

End Site: Ser220

Coverage: 0.61

Isoelectric Point: 6.5

Core Sequence: EVVNELYVDDPDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINKVPGNFHVSTHSATAQPQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSNPLASHDYILKIVPTVYEDKSGKQRYSYQYTVANKEYVAYS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: ERGIC32; KIAA1181

Alternative protein names: Endoplasmic reticulum-Golgi intermediate compartment protein 1; ER-Golgi intermediate compartment 32 kDa protein; ERGIC-32

Protein name: endoplasmic reticulum-golgi intermediate compartment 1

Full length: 290 amino acids

Entry name: ERGI1_HUMAN

• Artikelnummer: ASBPP-3798-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3798-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 57222