Recombinant Human ERMN Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TAM6

Gene Name: ERMN

Expression System: Escherichia coli

Molecular Weight: 33.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 58%

Start Site: Met1

End Site: Leu284

Coverage: 1.00

Isoelectric Point: 4.5

Core Sequence: MTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEERRKLQGNMLLNSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPLSGSNQEIRRQKERITEQPLKEEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSRYNTISYRKIRKGNTKQRIDEFESMMHL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 58%, Rat - 62%, Pig - 73%, Cynomolgus monkey - 93%

Alternative gene names: KIAA1189

Alternative protein names: Ermin; Juxtanodin; JN

Protein name: ermin

Full length: 284 amino acids

Entry name: ERMIN_HUMAN

• Artikelnummer: ASBPP-4050-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4050-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 57471