Recombinant Human ESYT3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A0FGR9

Gene Name: ESYT3

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 66%

Start Site: Arg561

End Site: Gly680

Coverage: 0.13

Isoelectric Point: 5

Core Sequence: RFQLDHSGLDSLISMRLVLRFLQVEERELGSPYTGPEALKKGPLLIKKVATNQGPKAQPQEEGPTDLPCPPDPASDTKDVSRSTTTTTSATTVATEPTSQETGPEPKGKDSAKRFCEPIG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 66%, Pig - 78%, Cynomolgus monkey - 94%

Alternative gene names: FAM62C

Alternative protein names: Extended synaptotagmin-3; E-Syt3; Chr3Syt

Protein name: extended synaptotagmin 3

Full length: 886 amino acids

Entry name: ESYT3_HUMAN

• Artikelnummer: ASBPP-3109-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3109-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 83850