Recombinant Human FAM169A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y6X4

Gene Name: FAM169A

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 59%

Start Site: Phe461

End Site: Asp540

Coverage: 0.13

Isoelectric Point: 5

Core Sequence: FNSSEDSTNLVPLVVESSKPPEVDAPDKTPRIPDSEMLMDEGTSDEKGHMEEKLSLLPRKKAHLGSSDNVATMSNEERSD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 59%, Pig - 78%

Alternative gene names: KIAA0888

Alternative protein names: Soluble lamin-associated protein of 75 kDa; SLAP75; Protein FAM169A

Protein name: family with sequence similarity 169 member A

Full length: 670 amino acids

Entry name: F169A_HUMAN

• Artikelnummer: ASBPP-3002-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3002-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 26049