Recombinant Human FANCE Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HB96

Gene Name: FANCE

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Arg221

End Site: Arg290

Coverage: 0.15

Isoelectric Point: 6

Core Sequence: RCWEEEEDHEKERPEHKSLESLADGGSASPIKDQPVMAVKTGEDGSNLDDAKGLAESLELPKAIQDQLPR

Homologies: Highest protein sequence identity to the following orthologs: Pig - 62%, Cynomolgus monkey - 89%

Alternative gene names: FACE

Alternative protein names: Fanconi anemia group E protein; Protein FACE

Protein name: FA complementation group E

Full length: 536 amino acids

Entry name: FANCE_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3197-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3197-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 2178