Recombinant Human FARP1 Protein

Recombinant Human FARP1 Protein
Artikelnummer
ASBPP-2968-100
Verpackungseinheit
100 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y4F1

Gene Name: FARP1

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Phe331

End Site: Glu530

Coverage: 0.20

Isoelectric Point: 8.5

Core Sequence: FSRGSSFRFSGRTQKQVLDYVKEGGHKKVQFERKHSKIHSIRSLASQPTELNSEVLEQSQQSTSLTFGEGAESPGGQSCRRGKEPKVSAGEPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHLSELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 78%, Pig - 74%, Cynomolgus monkey - 95%

Alternative gene names: CDEP; PLEKHC2

Alternative protein names: FERM; ARHGEF and pleckstrin domain-containing protein 1; Chondrocyte-derived ezrin-like protein; FERM; RhoGEF and pleckstrin domain-containing protein 1; Pleckstrin homology domain-containing family C member 2; PH domain-containing family C member 2

Protein name: FERM, ARH/RhoGEF and pleckstrin domain protein 1

Full length: 1045 amino acids

Entry name: FARP1_HUMAN
Mehr Informationen
Artikelnummer ASBPP-2968-100
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-2968-100
Verpackungseinheit 100 μg
Mengeneinheit STK
Human Gene ID 10160
Produktinformation (PDF)
×
MSDS (PDF)
×