Recombinant Human FARP1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y4F1

Gene Name: FARP1

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Phe331

End Site: Glu530

Coverage: 0.20

Isoelectric Point: 8.5

Core Sequence: FSRGSSFRFSGRTQKQVLDYVKEGGHKKVQFERKHSKIHSIRSLASQPTELNSEVLEQSQQSTSLTFGEGAESPGGQSCRRGKEPKVSAGEPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHLSELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 78%, Pig - 74%, Cynomolgus monkey - 95%

Alternative gene names: CDEP; PLEKHC2

Alternative protein names: FERM; ARHGEF and pleckstrin domain-containing protein 1; Chondrocyte-derived ezrin-like protein; FERM; RhoGEF and pleckstrin domain-containing protein 1; Pleckstrin homology domain-containing family C member 2; PH domain-containing family C member 2

Protein name: FERM, ARH/RhoGEF and pleckstrin domain protein 1

Full length: 1045 amino acids

Entry name: FARP1_HUMAN

• Artikelnummer: ASBPP-2968-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2968-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 10160