Recombinant Human FSTL1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q12841

Gene Name: FSTL1

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Lys151

End Site: Thr300

Coverage: 0.57

Isoelectric Point: 4.5

Core Sequence: KYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 92%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: FRP

Alternative protein names: Follistatin-related protein 1; Follistatin-like protein 1

Protein name: follistatin like 1

Full length: 308 amino acids

Entry name: FSTL1_HUMAN

• Artikelnummer: ASBPP-400-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-400-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 11167