Note: Dry Ice fees will be extra-charged
Uniprot: P22102
Gene Name: GART
Expression System: Escherichia coli
Molecular Weight: 23.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 88%
Start Site: Thr121
End Site: Tyr310
Coverage: 0.20
Isoelectric Point: 5
Core Sequence: TAQWKAFTKPEEACSFILSADFPALVVKASGLAAGKGVIVAKSKEEACKAVQEIMQEKAFGAAGETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYCPAPQVSNDLLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLTKNGPKVLEFNCRFGDPECQVILPLLKSDLY
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Pig - 92%, Cynomolgus monkey - 98%
Alternative gene names: PGFT; PRGS
Alternative protein names: Trifunctional purine biosynthetic protein adenosine-3 [Includes: Phosphoribosylamine--glycine ligase; Glycinamide ribonucleotide synthetase; GARS; Phosphoribosylglycinamide synthetase; Phosphoribosylformylglycinamidine cyclo-ligase; AIR synthase; AIRS; Phosphoribosyl-aminoimidazole synthetase; Phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase; GAR transformylase; GART]
Protein name: phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase
Full length: 1010 amino acids
Entry name: PUR2_HUMAN
Product panel: Enzyme
Deutsch
English
