Recombinant Human GATM Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P50440

Gene Name: GATM

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Pro61

End Site: Ala240

Coverage: 0.50

Isoelectric Point: 6.5

Core Sequence: PKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 94%, Pig - 95%, Cynomolgus monkey - 97%

Alternative gene names: AGAT

Alternative protein names: Glycine amidinotransferase; mitochondrial; L-arginine:glycine amidinotransferase; Transamidinase

Protein name: glycine amidinotransferase

Full length: 423 amino acids

Entry name: GATM_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-3876-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3876-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 2628