Recombinant Human GLRA2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P23416

Gene Name: GLRA2

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Pro121

End Site: Gly230

Coverage: 0.27

Isoelectric Point: 5

Core Sequence: PSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Glycine receptor subunit alpha-2

Protein name: glycine receptor alpha 2

Full length: 452 amino acids

Entry name: GLRA2_HUMAN

• Artikelnummer: ASBPP-4397-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4397-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 2742