Recombinant Human GNL3L Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NVN8

Gene Name: GNL3L

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Met421

End Site: Leu570

Coverage: 0.28

Isoelectric Point: 5.5

Core Sequence: MTEVFDIEDTEQANEDTMECLATGESDELLGDTDPLEMEIKLLHSPMTKIADAIENKTTVYKIGDLTGYCTNPNRHQMGWAKRNVDHRPKSNSMVDVCSVDRRSVLQRIMETDPLQQGQALASALKNKKKMQKRADKIASKLSDSMMSAL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Pig - 90%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Guanine nucleotide-binding protein-like 3-like protein

Protein name: G protein nucleolar 3 like

Full length: 582 amino acids

Entry name: GNL3L_HUMAN

• Artikelnummer: ASBPP-10445-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10445-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 54552