Recombinant Human GRIN2B Protein

Recombinant Human GRIN2B Protein
Artikelnummer
ASBPP-424-20
Verpackungseinheit
20 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: Q13224

Gene Name: GRIN2B

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Leu1251

End Site: Asp1380

Coverage: 0.10

Isoelectric Point: 9

Core Sequence: LYDISEDNSLQELDQPAAPVAVTSNASTTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPRSVSLKDKGRFMDGSPYAHMFEMSAGESTFANNKSSVPTAGHHHHNNPGGGYMLSKSLYPD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 96%, Pig - 93%, Cynomolgus monkey - 100%

Alternative gene names: NMDAR2B

Alternative protein names: Glutamate receptor ionotropic; NMDA 2B; GluN2B; Glutamate [NMDA] receptor subunit epsilon-2; N-methyl D-aspartate receptor subtype 2B; NMDAR2B; NR2B; N-methyl-D-aspartate receptor subunit 3; NR3; hNR3

Protein name: glutamate ionotropic receptor NMDA type subunit 2B

Full length: 1484 amino acids

Entry name: NMDE2_HUMAN

Product panel: Neurodegenerative Diseases Marker,Autoimmune Disease,Neuroscience Biomarkers
Mehr Informationen
Artikelnummer ASBPP-424-20
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-424-20
Verpackungseinheit 20 μg
Mengeneinheit STK
Human Gene ID 2904
Produktinformation (PDF)
×
MSDS (PDF)
×