Recombinant Human GRPEL1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HAV7

Gene Name: GRPEL1

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Cys28

End Site: Ala217

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: CTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 88%, Pig - 89%, Cynomolgus monkey - 99%

Alternative gene names: GREPEL1

Alternative protein names: GrpE protein homolog 1; mitochondrial; HMGE; Mt-GrpE#1

Protein name: GrpE like 1, mitochondrial

Full length: 217 amino acids

Entry name: GRPE1_HUMAN

• Artikelnummer: ASBPP-3993-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3993-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 80273