Recombinant Human HBM Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6B0K9

Gene Name: HBM

Expression System: Escherichia coli

Molecular Weight: 28.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 46%

Start Site: Ala11

End Site: Tyr140

Coverage: 0.96

Isoelectric Point: 6.5

Core Sequence: AQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHLSACQDATQLLSHGQRMLAAVGAAVQHVDNLRAALSPLADLHALVLRVDPANFPLLIQCFHVVLASHLQDEFTVQMQAAWDKFLTGVAVVLTEKY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 46%, Rat - 43%, Pig - 83%, Cynomolgus monkey - 97%

Alternative gene names: HBAP2

Alternative protein names: Hemoglobin subunit mu; Hemoglobin mu chain; Mu-globin

Protein name: hemoglobin subunit mu

Full length: 141 amino acids

Entry name: HBM_HUMAN

• Artikelnummer: ASBPP-4169-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4169-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 3042