Note: Dry Ice fees will be extra-charged
Uniprot: Q13547
Gene Name: HDAC1
Expression System: Escherichia coli
Molecular Weight: 25 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 99%
Start Site: His281
End Site: Lys480
Coverage: 0.42
Isoelectric Point: 4.5
Core Sequence: HAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%
Alternative gene names: RPD3L1
Alternative protein names: Histone deacetylase 1; HD1; Protein deacetylase HDAC1; Protein decrotonylase HDAC1
Protein name: histone deacetylase 1
Full length: 482 amino acids
Entry name: HDAC1_HUMAN
Product panel: DNA binding & Chromatin,Enzyme
Deutsch
English
