Recombinant Human HDAC1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q13547

Gene Name: HDAC1

Expression System: Escherichia coli

Molecular Weight: 25 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: His281

End Site: Lys480

Coverage: 0.42

Isoelectric Point: 4.5

Core Sequence: HAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: RPD3L1

Alternative protein names: Histone deacetylase 1; HD1; Protein deacetylase HDAC1; Protein decrotonylase HDAC1

Protein name: histone deacetylase 1

Full length: 482 amino acids

Entry name: HDAC1_HUMAN

Product panel: DNA binding & Chromatin,Enzyme

• Artikelnummer: ASBPP-435-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-435-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 3065