Recombinant Human HDHD2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H0R4

Gene Name: HDHD2

Expression System: Escherichia coli

Molecular Weight: 29.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Met1

End Site: Leu259

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 90%

Alternative gene names: /

Alternative protein names: Haloacid dehalogenase-like hydrolase domain-containing protein 2

Protein name: haloacid dehalogenase like hydrolase domain containing 2

Full length: 259 amino acids

Entry name: HDHD2_HUMAN

• Artikelnummer: ASBPP-3988-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3988-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 84064