Research Areas: Others
Uniprot: Q77Z83
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: C-terminal 6xHis-tagged
Purity: Greater than 95% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 27.3 kDa
Gene Names: U90/U87/U86
Organism: Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)
Source: E.coli
Expression Region: 1324-1500aa
Protein Length: Partial
Target Protein Sequence: KQIPKKPCNEKNLKEAVYDICCNGLSNNAAIIMYFTRSKKVAQIIKIMQKELMIRPNITVSEAFKMNHAPPKYYDKDEIKRFIQLQKQGPQELWDKFENNTTHDLFTRHSDVKTMIIYAATPIDFVGAVKTCNKYAKDNPKEIVLRVCSIIDGDNPISIYNPISKEFKSKFSTLSKC
Endotoxin: Not test.
Biological_Activity: Not Test
Relevance: Transcriptional transactivator.