Recombinant Human HEXIM2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96MH2

Gene Name: HEXIM2

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Arg151

End Site: Cys280

Coverage: 0.47

Isoelectric Point: 5.5

Core Sequence: RDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSKQELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Rat - 45%, Pig - 87%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Protein HEXIM2; Hexamethylene bis-acetamide-inducible protein 2

Protein name: HEXIM P-TEFb complex subunit 2

Full length: 286 amino acids

Entry name: HEXI2_HUMAN

• Artikelnummer: ASBPP-10489-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10489-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 124790