Recombinant Human HIBADH Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P31937

Gene Name: HIBADH

Expression System: Escherichia coli

Molecular Weight: 32.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Ala37

End Site: Phe336

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: ASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 93%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: 3-hydroxyisobutyrate dehydrogenase; mitochondrial; HIBADH

Protein name: 3-hydroxyisobutyrate dehydrogenase

Full length: 336 amino acids

Entry name: 3HIDH_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-3943-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3943-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 11112