Recombinant Human HMGCR Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P04035

Gene Name: HMGCR

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Lys351

End Site: Lys460

Coverage: 0.13

Isoelectric Point: 6

Core Sequence: KNPITSPVVTQKKVPDNCCRREPMLVRNNQKCDSVEEETGINRERKVEVIKPLVAETDTPNRATFVVGNSSLLDTSSVLVTQEPEIELPREPRPNEECLQILGNAEKGAK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 74%, Pig - 83%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: 3-hydroxy-3-methylglutaryl-coenzyme A reductase; HMG-CoA reductase

Protein name: 3-hydroxy-3-methylglutaryl-CoA reductase

Full length: 888 amino acids

Entry name: HMDH_HUMAN

Product panel: Autoimmune Disease,Enzyme

• Artikelnummer: ASBPP-4354-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4354-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 3156