Recombinant Human HOXB13 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q92826

Gene Name: HOXB13

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Asp161

End Site: Asn280

Coverage: 0.45

Isoelectric Point: 10.5

Core Sequence: DSLLPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRRGRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 51%, Pig - 92%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Homeobox protein Hox-B13

Protein name: homeobox B13

Full length: 284 amino acids

Entry name: HXB13_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-11472-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-11472-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 10481