Recombinant Human HPRT1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P00492

Gene Name: HPRT1

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Met1

End Site: Ala218

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 95%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: HPRT

Alternative protein names: Hypoxanthine-guanine phosphoribosyltransferase; HGPRT; HGPRTase

Protein name: hypoxanthine phosphoribosyltransferase 1

Full length: 218 amino acids

Entry name: HPRT_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-4347-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4347-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 3251