Recombinant Human INHBC Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P55103

Gene Name: INHBC

Expression System: Escherichia coli

Molecular Weight: 55 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Gly237

End Site: Ser352

Coverage: 1.00

Isoelectric Point: 5

Core Sequence: GIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 91%, Pig - 95%

Alternative gene names: /

Alternative protein names: Inhibin beta C chain; Activin beta-C chain

Protein name: inhibin subunit beta C

Full length: 352 amino acids

Entry name: INHBC_HUMAN

Product panel: Cytokines,Autoimmune Disease

• Artikelnummer: ASBPP-3741-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3741-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 3626