Recombinant Human IPO7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O95373

Gene Name: IPO7

Expression System: Escherichia coli

Molecular Weight: 72.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Phe761

End Site: Met1010

Coverage: 0.25

Isoelectric Point: 4.5

Core Sequence: FVEAALERLTREVKTSELRTMCLQVAIAALYYNPHLLLNTLENLRFPNNVEPVTNHFITQWLNDVDCFLGLHDRKMCVLGLCALIDMEQIPQVLNQVSGQILPAFILLFNGLKRAYACHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: RANBP7

Alternative protein names: Importin-7; Imp7; Ran-binding protein 7; RanBP7

Protein name: importin 7

Full length: 1038 amino acids

Entry name: IPO7_HUMAN

• Artikelnummer: ASBPP-4341-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4341-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 10527