Recombinant Human IPO8 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O15397

Gene Name: IPO8

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Glu891

End Site: Lys1010

Coverage: 0.12

Isoelectric Point: 4

Core Sequence: EKADMEENEEISSDEEETNVTAQAMQSNNGRGEDEEEEDDDWDEEVLEETALEGFSTPLDLDNSVDEYQFFTQALITVQSRDAAWYQLLMAPLSEDQRTALQEVYTLAEHRRTVAEAKKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Pig - 95%, Cynomolgus monkey - 100%

Alternative gene names: RANBP8

Alternative protein names: Importin-8; Imp8; Ran-binding protein 8; RanBP8

Protein name: importin 8

Full length: 1037 amino acids

Entry name: IPO8_HUMAN

• Artikelnummer: ASBPP-4321-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4321-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 10526