Recombinant Human Keratin, type II cytoskeletal 7 (KRT7)

Recombinant Human Keratin, type II cytoskeletal 7 (KRT7)
Artikelnummer
CSB-EP012564HU-1
Verpackungseinheit
1 mg
Hersteller
Cusabio

Verfügbarkeit: wird geladen...
Preis wird geladen...
Research Areas: Signal Transduction

Uniprot: P08729

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 6xHis-SUMO-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 67.3 kDa

Gene Names: KRT7

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 2-469aa

Protein Length: Full Length of Mature Protein

Target Protein Sequence: SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD

Endotoxin: Not test.

Relevance: Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).

Reference: "Sequence and expression of a human type II mesothelial keratin."Glass C., Kim K.H., Fuchs E.J. Cell Biol. 101:2366-2373(1985)

Function: Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
Mehr Informationen
Artikelnummer CSB-EP012564HU-1
Hersteller Cusabio
Hersteller Artikelnummer CSB-EP012564HU-1
Verpackungseinheit 1 mg
Mengeneinheit STK
Reaktivität Human
Methode SDS-PAGE
Wirt Escherichia Coli
Produktinformation (PDF) Download
MSDS (PDF) Download