Recombinant Human LAMC2 Protein

Recombinant Human LAMC2 Protein
Artikelnummer
ASBPP-4301-20
Verpackungseinheit
20 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: Q13753

Gene Name: LAMC2

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Ala1011

End Site: Leu1190

Coverage: 0.15

Isoelectric Point: 4.5

Core Sequence: AGEALEISSEIEQEIGSLNLEANVTADGALAMEKGLASLKSEMREVEGELERKELEFDTNMDAVQMVITEAQKVDTRAKNAGVTIQDTLNTLDGLLHLMDQPLSVDEEGLVLLEQKLSRAKTQINSQLRPMMSELEERARQQRGHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQAL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Pig - 80%, Cynomolgus monkey - 94%

Alternative gene names: LAMB2T; LAMNB2

Alternative protein names: Laminin subunit gamma-2; Cell-scattering factor 140 kDa subunit; CSF 140 kDa subunit; Epiligrin subunit gamma; Kalinin subunit gamma; Kalinin/nicein/epiligrin 100 kDa subunit; Ladsin 140 kDa subunit; Laminin B2t chain; Laminin-5 subunit gamma; Large adhesive scatter factor 140 kDa subunit; Nicein subunit gamma

Protein name: laminin subunit gamma 2

Full length: 1193 amino acids

Entry name: LAMC2_HUMAN
Mehr Informationen
Artikelnummer ASBPP-4301-20
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-4301-20
Verpackungseinheit 20 μg
Mengeneinheit STK
Human Gene ID 3918
Produktinformation (PDF)
×
MSDS (PDF)
×