Recombinant Human LBX1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P52954

Gene Name: LBX1

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Asp111

End Site: Asp280

Coverage: 0.64

Isoelectric Point: 6.5

Core Sequence: DGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 94%, Pig - 97%, Cynomolgus monkey - 96%

Alternative gene names: LBX1H

Alternative protein names: Transcription factor LBX1; Ladybird homeobox protein homolog 1

Protein name: ladybird homeobox 1

Full length: 281 amino acids

Entry name: LBX1_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-4162-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4162-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 10660