Recombinant Human LGALS14 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TCE9

Gene Name: LGALS14

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 54%

Start Site: Met1

End Site: Asp139

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 54%, Rat - 37%, Pig - 53%, Cynomolgus monkey - 97%

Alternative gene names: PPL13

Alternative protein names: Placental protein 13-like; Charcot-Leyden crystal protein 2; CLC2; Galectin-14; Gal-14

Protein name: galectin 14

Full length: 139 amino acids

Entry name: PPL13_HUMAN

• Artikelnummer: ASBPP-3239-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3239-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 56891