Recombinant Human LRRC31 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6UY01

Gene Name: LRRC31

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Val21

End Site: Thr100

Coverage: 0.17

Isoelectric Point: 7.5

Core Sequence: VNKFLRGSNAESRKEDNDLKTSDSQPSDWIQKTATSETAKPLSSEMEWRSSMEKNEHFLQKLGKKAVNKCLDLNNCGLTT

Homologies: Highest protein sequence identity to the following orthologs: Pig - 73%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Leucine-rich repeat-containing protein 31

Protein name: leucine rich repeat containing 31

Full length: 552 amino acids

Entry name: LRC31_HUMAN

• Artikelnummer: ASBPP-4187-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4187-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 79782