Recombinant Human LYPLAL1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q5VWZ2

Gene Name: LYPLAL1

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Gly71

End Site: Pro230

Coverage: 0.71

Isoelectric Point: 7

Core Sequence: GGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAIHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 33%, Pig - 85%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Lysophospholipase-like protein 1

Protein name: lysophospholipase like 1

Full length: 237 amino acids

Entry name: LYPL1_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-3889-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3889-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 127018