Recombinant Human MAML2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IZL2

Gene Name: MAML2

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Glu271

End Site: Glu360

Coverage: 0.08

Isoelectric Point: 5

Core Sequence: ETLSCSKHMDGQMTQENIFPNRYGDDPGEQLMDPELQELFNELTNISVPPMSDLELENMINATIKQDDPFNIDLGQQSQRSTPRPSLPME

Homologies: Highest protein sequence identity to the following orthologs: Pig - 95%

Alternative gene names: KIAA1819

Alternative protein names: Mastermind-like protein 2; Mam-2

Protein name: mastermind like transcriptional coactivator 2

Full length: 1156 amino acids

Entry name: MAML2_HUMAN

• Artikelnummer: ASBPP-3750-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3750-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 84441