Recombinant Human MCMBP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BTE3

Gene Name: MCMBP

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Asn91

End Site: Asn220

Coverage: 0.22

Isoelectric Point: 6.5

Core Sequence: NTKAHVLHFGKYRDVAECGPQQELDLNSPRNTTLERQTFYCVPVPGESTWVKEAYVNANQARVSPSTSYTPSRHKRSYEDDDDMDLQPNKQKDQHAGARQAGSVGGLQWCGEPKRLETEASTGQQLNSLN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 92%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: C10orf119

Alternative protein names: Mini-chromosome maintenance complex-binding protein; MCM-BP; MCM-binding protein

Protein name: minichromosome maintenance complex binding protein

Full length: 642 amino acids

Entry name: MCMBP_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-10456-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10456-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 79892