Recombinant Human MDH1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P40925

Gene Name: MDH1

Expression System: Escherichia coli

Molecular Weight: 37.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Met1

End Site: Ala334

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 97%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: MDHA

Alternative protein names: Malate dehydrogenase; cytoplasmic; Aromatic alpha-keto acid reductase; KAR; Cytosolic malate dehydrogenase

Protein name: malate dehydrogenase 1

Full length: 334 amino acids

Entry name: MDHC_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-3825-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3825-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 4190