Recombinant Human MED24 Protein

Recombinant Human MED24 Protein
Artikelnummer
ASBPP-3234-20
Verpackungseinheit
20 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: O75448

Gene Name: MED24

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Ala351

End Site: Lys430

Coverage: 0.08

Isoelectric Point: 7

Core Sequence: ADQRCNCDCTNFLLQECGKQGLLSEASVNNLMAKRKADREHAPQQKSGENANIQPNIQLILRAEPTVTNILKTMDADHSK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 84%, Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: ARC100; CRSP4; DRIP100; KIAA0130; THRAP4; TRAP100

Alternative protein names: Mediator of RNA polymerase II transcription subunit 24; Activator-recruited cofactor 100 kDa component; ARC100; Cofactor required for Sp1 transcriptional activation subunit 4; CRSP complex subunit 4; Mediator complex subunit 24; Thyroid hormone receptor-associated protein 4; Thyroid hormone receptor-associated protein complex 100 kDa component; Trap100; hTRAP100; Vitamin D3 receptor-interacting protein complex 100 kDa component; DRIP100

Protein name: mediator complex subunit 24

Full length: 989 amino acids

Entry name: MED24_HUMAN
Mehr Informationen
Artikelnummer ASBPP-3234-20
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-3234-20
Verpackungseinheit 20 μg
Mengeneinheit STK
Human Gene ID 9862
Produktinformation (PDF)
×
MSDS (PDF)
×